DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and LOC100360117

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_002729189.1 Gene:LOC100360117 / 100360117 RGDID:2322732 Length:257 Species:Rattus norvegicus


Alignment Length:279 Identity:62/279 - (22%)
Similarity:103/279 - (36%) Gaps:89/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVVEKPKPGAGQQFRRTVHFPEKYTVEPLKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVRD 97
            :|:...:.|||..||  .|           :.|..|    :.||.|....    :::.::|.:  
  Rat     3 RVIRGQRKGAGSVFR--AH-----------VKHRKG----AARLRAVDFA----ERHGYIKGI-- 44

  Fly    98 GPTEGAQEELVLEVLRDGCRTAKVALVAVGDELKYILATENMKAGDILKTSRFI-PRIPVRPNEG 161
                      |.:::.|..|.|.:|.|...|..::...||...|.:.:.|.:|: .....:.|.|
  Rat    45 ----------VKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIG 99

  Fly   162 DAYPLGALPVGTRIHCLEKNPGQMCHLIHAAGTFGTILRKFDE--KVVVQLPS------------ 212
            :..|:|.:|.||.:.|||:.||....|..|:|.:.|::....|  |..|:|||            
  Rat   100 NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRA 164

  Fly   213 ---------------------KREFAFQRTCMATV-GRLSNP-EH-----NKEHVGSAQRMREMG 249
                                 ..::..:|.|...| |...|| ||     |.:|:|....:    
  Rat   165 VVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTI---- 225

  Fly   250 NRPRSGLWKRKEGKHGRKI 268
                     |::...|||:
  Rat   226 ---------RRDAPAGRKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 15/78 (19%)
Ribosomal_L2_C 161..275 CDD:281880 36/150 (24%)
LOC100360117XP_002729189.1 RplB 1..254 CDD:424298 62/279 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.