DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and mrpl2

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001096416.1 Gene:mrpl2 / 100125021 XenbaseID:XB-GENE-6454706 Length:287 Species:Xenopus tropicalis


Alignment Length:238 Identity:118/238 - (49%)
Similarity:154/238 - (64%) Gaps:12/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KYTVEPLKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVRDGPTEGAQ----EELVLEVLRDG 115
            |||:.|:.:....|||. :||:..:|||||.||.||.|.:.|.....|.:    :|.|:||..|.
 Frog    51 KYTINPIGVKKTGGRDH-TGRIRTRGIGGGHKQLYRMVDFQRLNYVPGQEPRPFQEKVIEVRYDP 114

  Fly   116 CRTAKVALVAVGDELK-YILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCLE 179
            ||:|.:|||| ||:.| :|:|||||:.||::.:|..|.|:.|...||||:|||||||||.|:.||
 Frog   115 CRSADIALVA-GDKRKRWIIATENMQEGDLITSSGHIGRMAVSAKEGDAHPLGALPVGTLINNLE 178

  Fly   180 KNPGQMCHLIHAAGTFGTILRKFDEKVVVQLPSKREFAFQRTCMATVGRLSNPEHNKEHVGSAQR 244
            ..||:....|.||||.|.:|||.:...:|||||||:.....||:|||||:||.:|||..:|.|.|
 Frog   179 FQPGKGAQYIRAAGTCGVLLRKVNGTAIVQLPSKRQIQVSETCVATVGRVSNIDHNKRIIGKAGR 243

  Fly   245 MREMGNRPRSGLWKRKEGKHGRKIRRLPPMTTI-----SPPAP 282
            .|.:|.||.|||||||.|..||||:.||.:.:.     :.|||
 Frog   244 NRWLGIRPSSGLWKRKGGWAGRKIKPLPGLKSYVQLPSALPAP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 40/83 (48%)
Ribosomal_L2_C 161..275 CDD:281880 66/113 (58%)
mrpl2NP_001096416.1 Ribosomal_L2_C 28..>252 CDD:332035 100/202 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10120
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003807
OrthoInspector 1 1.000 - - oto103200
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3165
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.