DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and FOXQ1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_150285.3 Gene:FOXQ1 / 94234 HGNCID:20951 Length:403 Species:Homo sapiens


Alignment Length:269 Identity:76/269 - (28%)
Similarity:115/269 - (42%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 APPAGAAAHLIAGD-------GPGIYSPLKISIPKKEQKSPYLSPTGTIS-AANSCPASPRQGFI 421
            :|.||..|....||       |||           .|:..|..:....:: .|.:..|.|..|  
Human    50 SPAAGGGARDTQGDGEQSAGGGPG-----------AEEAIPAAAAAAVVAEGAEAGAAGPGAG-- 101

  Fly   422 QNQPNNYNNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKH 486
                      |..:.:.....|    |....||||||..||..||..:...:|||:.|..:::..
Human   102 ----------GAGSGEGARSKP----YTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGK 152

  Fly   487 YPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEP-GKGSFWRIDPDSGAKLIDHSYKKRRQRS 550
            :|::| .:..||:||:|||||||..|:||.|....| ||.::|.::|:|.....|..:::||:|.
Human   153 FPFFR-GSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRL 216

  Fly   551 SQ-------GFRPPY--GMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGM---SLEQRAADP 603
            |.       |.||..  |:|.:.|.:|                  :||.||.|   :.::..|.|
Human   217 SHRAPVPAPGLRPEEAPGLPAAPPPAP------------------AAPASPRMRSPARQEERASP 263

  Fly   604 EIIYNSQNA 612
            ...::|..|
Human   264 AGKFSSSFA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 37/87 (43%)
FOXQ1NP_150285.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 9/35 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 6/37 (16%)
FH 119..197 CDD:238016 35/78 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..266 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.