DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and AT3G07260

DIOPT Version :10

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_187382.1 Gene:AT3G07260 / 819914 AraportID:AT3G07260 Length:251 Species:Arabidopsis thaliana


Alignment Length:139 Identity:36/139 - (25%)
Similarity:52/139 - (37%) Gaps:41/139 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VIGRNSSTSLVHFNVAE---NNLVSRKHFQVLYDVELRAFFVQCLSKNGIFVDDFLQ---RRNV- 229
            ::||||..|.|..:::.   ...:||.|.::.||...|.|.::.|.|||.||:..|.   ..|| 
plant    33 ILGRNSKKSTVDVDLSSLGGGMNISRNHARIFYDFTRRRFSLEVLGKNGCFVEGVLHLPGNPNVK 97

  Fly   230 ----DPLRL-PQRCYFRFPSTEIRIEFESYVPATSSDAIDGHSPSLVVGGGGGVAGGGAHVI--I 287
                |.|:: .:..||..|...|.                           ||..|...||:  .
plant    98 LDSQDLLQIGDKEFYFLLPVWSIL---------------------------GGPLGPRHHVLGKA 135

  Fly   288 TPLPRDELH 296
            |.:|....|
plant   136 TVVPYHNYH 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA_FOXK 151..252 CDD:438740 28/91 (31%)
FH_FOXK 453..531 CDD:410800
AT3G07260NP_187382.1 FHA_FKH1-like 14..116 CDD:438753 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.