DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxc1b

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_571804.1 Gene:foxc1b / 79375 ZFINID:ZDB-GENE-010302-2 Length:433 Species:Danio rerio


Alignment Length:316 Identity:92/316 - (29%)
Similarity:139/316 - (43%) Gaps:59/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
            ||||||..||..||..:.||::||:|||.||::.:|:|| :..:|||||||||||||..|:||.|
Zfish    74 KPPYSYIALITMAIQNSSDKKITLNGIYQFIMERFPFYR-DNKQGWQNSIRHNLSLNECFVKVPR 137

  Fly   518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR--SSQGFRPPYGMPRSAPVSPSHM--DNSRESS 578
            ...:|||||:|.:||||.....:.|:.:||:|  .....|......|....:|...  .::::..
Zfish   138 DDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVLREKEDRDRQGKDNPGQACEQDAQQPV 202

  Fly   579 PLQDIVLQSA------PGSPGMSLEQRAADPEIIYNSQ-NAHQQQQQQQQQQQQQTLS---NNSN 633
            .|:||..::.      ..:|.:|...:...|:....|. :...|.|..||.....|:.   ..|.
Zfish   203 KLRDIKTENGACTPPHDSTPPLSTVPKTESPDRSGGSACSGSPQSQTPQQAFSMDTIMTGLRGSP 267

  Fly   634 QYSSGSP-------------YYVTNQSSGVATP-------QTHVEGSAASGGGGGGGVGAL---- 674
            |:::..|             |..|.|.:..:.|       ..:::.::...|..|.|...|    
Zfish   268 QHAAELPASRAALPGSVSLTYSPTPQPAHYSPPCGQPATYHCNMQATSLYTGDRGHGDDTLPEYT 332

  Fly   675 -----LALKRNHVMGGGASQHTLHQQQAVAQ---QQHSEIIYEELPTDYSGHIEAS 722
                 .::...|......|||.  ||..:|.   .|..|:          ||:.||
Zfish   333 NTTNASSISHPHQSSSQESQHL--QQNRLAPWYLNQSGEL----------GHLSAS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/86 (57%)
foxc1bNP_571804.1 Forkhead 74..160 CDD:278670 49/86 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..250 12/75 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..355 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.