DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxj1a

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001070174.2 Gene:foxj1a / 767737 ZFINID:ZDB-GENE-060929-1178 Length:458 Species:Danio rerio


Alignment Length:423 Identity:107/423 - (25%)
Similarity:155/423 - (36%) Gaps:151/423 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 AHLIAGDGPGIYSPL-----KISIPKKEQKSPYLSPTGTISAANSC--------PASPRQGFIQN 423
            :||:..|.|.  |||     .|.:|        |:| |..:||:.|        |:....|    
Zfish    78 SHLMGSDAPS--SPLAGDPASIGMP--------LTP-GKPTAASFCRVPMFSALPSLVAHG---- 127

  Fly   424 QPNNYNNYGNNNTQDLFQTPSTASYNHNE--KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKH 486
                             ..|....|..|.  |||||||.||..|:.|:...::|||.||.:|..:
Zfish   128 -----------------HCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDN 175

  Fly   487 YPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSS 551
            :.|:| ..:..||||||||||||:.||||.|.:||||||.||:|||....:|::.:|||||    
Zfish   176 FCYFR-HADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNEAYKKRR---- 235

  Fly   552 QGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSP-----------GMSLEQ----RAA 601
               .||      ..::|:.....|.::....::.::...||           ..|.:|    |.|
Zfish   236 ---LPP------VQINPALQHRLRMNAQATGVISRNLSVSPESQQLLKDFEEATSADQNWDPRLA 291

  Fly   602 DPEII---------------YNSQNAHQQQQQQQQ---QQQQQTLS----------------NNS 632
            :..::               ||.:.....::....   ..:|:.||                |..
Zfish   292 EATMLSCWISGKGTNKRKQPYNHRTGKTPRRSSSPLLVMDEQEDLSSLRGNFDWDALLDSALNGE 356

  Fly   633 NQYSSGSPYYVTNQSSGVATPQTHVEGSAASGGGGGGGVGALLALKRNHVMGGGASQHTLHQQQA 697
            ...:.|||...|.|...:....||:....|.              ..|||:              
Zfish   357 LSLNEGSPLSPTPQDEELMIRGTHISPQEAP--------------VENHVL-------------- 393

  Fly   698 VAQQQHSEIIYEELPTDYSGHIEASEEECVTTA 730
                         :.|..||..:..||..:.||
Zfish   394 -------------METQRSGDEDFDEETFLATA 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 48/86 (56%)
foxj1aNP_001070174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..99 8/22 (36%)
Forkhead 142..228 CDD:278670 48/86 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..324 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.