DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxr1

DIOPT Version :10

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001037918.1 Gene:foxr1 / 733531 XenbaseID:XB-GENE-484980 Length:293 Species:Xenopus tropicalis


Alignment Length:80 Identity:26/80 - (32%)
Similarity:45/80 - (56%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
            :||.:|..||..|:..:.|..|.:..||||:.:|:|::|...: ||:|::||||..:..|.|.:.
 Frog   176 RPPLNYCNLISLALRNSEDGSLNVQQIYSFVREHFPFFRIAPD-GWKNTVRHNLCFSSSFEKSSG 239

  Fly   518 --SQDEPGKGSFWRI 530
              ..|...:...|::
 Frog   240 WVCADGHRRSCLWKL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA_FOXK 151..252 CDD:438740
FH_FOXK 453..531 CDD:410800 26/80 (33%)
foxr1NP_001037918.1 COG5025 <94..>236 CDD:227358 23/60 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..152
FH_FOXR 174..260 CDD:410810 26/80 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.