DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxl3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_038945901.1 Gene:Foxl3 / 680273 RGDID:1594158 Length:216 Species:Rattus norvegicus


Alignment Length:227 Identity:68/227 - (29%)
Similarity:101/227 - (44%) Gaps:55/227 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 YNNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRK 492
            ||.:  |:..|.:...|........:|.|||..||..||..:|..::||||||.||::.:|||| 
  Rat     9 YNCF--NDDADDYPAGSADEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYR- 70

  Fly   493 ETNKGWQNSIRHNLSLNRYFIKVARSQ-DEPGKGSFWRIDPDSGA--KLID----HSYKKRRQRS 550
            ...:.||||||||||||..|:||.|:: .:.|||::|..   :|.  .|:|    .::::||:| 
  Rat    71 ANQRAWQNSIRHNLSLNSCFVKVPRTEGHDKGKGNYWTF---AGGCESLLDLFENGNFRRRRRR- 131

  Fly   551 SQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAA-------------- 601
                |.|.......|:.|:               .:.:||..|.....|.|              
  Rat   132 ----RGPKSEEAPGPLQPA---------------ARGSPGPDGTQAPDREAQARLVTHRDIKFSI 177

  Fly   602 -------DPEIIYNSQNAHQQQQQQQQQQQQQ 626
                   ||..:..| :.|.|:.:....:.||
  Rat   178 DYILSSPDPFPVLRS-SCHSQEARYPTLEPQQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 43/89 (48%)
Foxl3XP_038945901.1 Forkhead 32..115 CDD:395192 42/86 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.