DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxh1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_571577.1 Gene:foxh1 / 57930 ZFINID:ZDB-GENE-000616-15 Length:472 Species:Danio rerio


Alignment Length:244 Identity:70/244 - (28%)
Similarity:108/244 - (44%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 GPGIYSPLKISIPKKEQKSPYLS-PTGTISAANSC-----PASPRQGFIQN-----QPNNYNNYG 432
            |||:.:|..|::.:..|:..:|. ..|..|:..||     |.....|.:..     |.:.|....
Zfish     7 GPGLLAPPVITVGEGAQRDHHLDCRIGYSSSKRSCHRSSNPLLELGGRLDKSTGMAQDSCYRAKA 71

  Fly   433 NNNTQDLFQTPSTA-----SYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRK 492
            .|......|..:::     :|....||||||..:|...|..:|:|:||||.|...|...:|:: |
Zfish    72 TNQGPWELQDGNSSGGKKKNYQRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFF-K 135

  Fly   493 ETNKGWQNSIRHNLSLNRYFIKVARSQDEP-GKGSFWRIDPDSGAKLIDHSYKKRRQRS------ 550
            ...|||::|:|||||....|:||.:...:| |||:||.::    ...|.....||:..:      
Zfish   136 GNYKGWRDSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTVE----VNRIPLELLKRQNTAVSRQDE 196

  Fly   551 ---SQGFRP----PYGMP-RSAPVSPSHMDNSRESSPLQDIVLQSAPGS 591
               :|...|    .|..| :|.|:.|   ::|....|.:    ||.|.|
Zfish   197 TIFAQDLAPYIFQGYSQPNKSKPLPP---ESSLPPVPTR----QSPPPS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 36/87 (41%)
foxh1NP_571577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 5/19 (26%)
FH 97..174 CDD:238016 36/77 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..246 11/35 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..360
SMAD-interaction domain (SID) 339..465
Fast/FoxH1 motif 1 (FM1) 357..361
Fast/FoxH1 motif 2 (FM2) 367..373
SMAD interaction motif (SIM) 428..448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.