DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxg1c

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:226 Identity:81/226 - (35%)
Similarity:115/226 - (50%) Gaps:48/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVA 516
            :|||:||..||:.||..:|:::|||:|||.||:.::|||| |..:|||||||||||||:.|:||.
Zfish    89 DKPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYR-ENRQGWQNSIRHNLSLNKCFVKVP 152

  Fly   517 RSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQ 581
            |..|:||||::|.:||.|....|..:..|.|:||:...|....|.|.|          |.||...
Zfish   153 RHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTAASRAKLAMKRGA----------RLSSTAA 207

  Fly   582 DIVLQSA-----PGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSP- 640
            ...|..|     |..|.::|:.|.:.|...::|..|            ...||.::..:||.:| 
Zfish   208 SAGLAFAGSFYWPVPPFVTLQHRHSSPAAAHHSNYA------------ASVLSQSARHFSSVAPA 260

  Fly   641 -------------YY------VTNQSSGVAT 652
                         ||      :|:.||..:|
Zfish   261 AERLLIPSSQEATYYGMGCEQMTSSSSSFST 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/86 (57%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 50/88 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.