DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxr1

DIOPT Version :10

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001096594.1 Gene:foxr1 / 570997 ZFINID:ZDB-GENE-070928-26 Length:321 Species:Danio rerio


Alignment Length:90 Identity:30/90 - (33%)
Similarity:48/90 - (53%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
            :||.:|..||..|:|::....|.:..||:|..:|:|::....: ||:|:|||||..:..|.|..:
Zfish   204 RPPVNYCILIAMALSSSRSGSLNVQQIYNFTREHFPFFLTAPD-GWKNTIRHNLCFSNSFKKTPQ 267

  Fly   518 --SQDEPGKGSFWRIDPDSGAKLID 540
              |.|...|...|.:..|...:|.|
Zfish   268 QVSGDGKRKSCLWHLTLDGRQRLRD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA_FOXK 151..252 CDD:438740
FH_FOXK 453..531 CDD:410800 27/79 (34%)
foxr1NP_001096594.1 COG5025 <104..>280 CDD:227358 26/76 (34%)
FH_FOXR 202..288 CDD:410810 28/84 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.