DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxe1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_005159967.1 Gene:foxe1 / 567676 ZFINID:ZDB-GENE-061116-1 Length:354 Species:Danio rerio


Alignment Length:299 Identity:90/299 - (30%)
Similarity:132/299 - (44%) Gaps:47/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 IPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNEKP 454
            :.|.|..||  |.| |:...:|..|.|::|..:.:|                       ....||
Zfish     3 VVKVESDSP--SET-TLPVNDSQRAEPQRGRRRKRP-----------------------LQRGKP 41

  Fly   455 PYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQ 519
            ||||..||..||:.:||::|||.|||.||.:.:|:|| :.:|.|||||||||:||..|||:.|..
Zfish    42 PYSYIALISMAIANSPDRKLTLGGIYKFITERFPFYR-DNSKKWQNSIRHNLTLNDCFIKIPREP 105

  Fly   520 DEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQG-FRPPYGMPRSAPV-SPSHMDNSRESSPLQD 582
            ..||||::|.:||::.......|:.:||:|..:. |.........:|| ||..:..|..::.:..
Zfish   106 GRPGKGNYWALDPNAEDMFESGSFLRRRKRFKRSDFTTYSSYVHESPVFSPVQIARSAYANSVYS 170

  Fly   583 IVLQSAP------------GSPGMSLEQ-RAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQ 634
            .:..|.|            .||..:..| |......:..|.:...|..:...||..::.|..|..
Zfish   171 NMAVSPPYAQQLPSAYYQSSSPNFTAGQSRVFRINSLIGSPSRMGQNAEMIPQQSCRSFSPESGS 235

  Fly   635 YSSGSPYYVTNQSSGVATPQTHVEGS-----AASGGGGG 668
            .|.|.|.:.....:|......:...|     |.||.|.|
Zfish   236 CSLGGPGFQHQSCNGETVLSCYSSSSNNMAFAYSGPGHG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
foxe1XP_005159967.1 FH 40..128 CDD:214627 46/88 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.