DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and si:rp71-45k5.2

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001038405.1 Gene:si:rp71-45k5.2 / 560783 ZFINID:ZDB-GENE-060503-753 Length:255 Species:Danio rerio


Alignment Length:91 Identity:31/91 - (34%)
Similarity:50/91 - (54%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 SYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDE 521
            :|..||..||..:|||:||...|   :.|..|:...| .:..:|:||..||.|:.|:||....|.
Zfish    31 TYTGLIAYAIQESPDKKLTFKEI---MTKLEPFVFGE-KRSIENNIRVCLSSNKCFVKVPVDPDY 91

  Fly   522 PG-KGSFWRIDPDSG--AKLIDHSYK 544
            |. |.::|::| ::|  .|::...:|
Zfish    92 PNPKKNYWKVD-ENGITPKMLRRHFK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 30/85 (35%)
si:rp71-45k5.2NP_001038405.1 FH 31..102 CDD:294049 27/74 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.