DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxj2

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_686801.4 Gene:foxj2 / 558490 ZFINID:ZDB-GENE-100922-240 Length:516 Species:Danio rerio


Alignment Length:244 Identity:73/244 - (29%)
Similarity:104/244 - (42%) Gaps:77/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFI 513
            |...|||:|||.||..|||:||:.:|:|:.||::|...:|||.: ..:||:||||||||||:.|.
Zfish    53 NSKVKPPHSYATLIAMAISSAPEMKLSLNDIYTWISDTFPYYCR-AGRGWKNSIRHNLSLNKCFR 116

  Fly   514 KVARSQDEPGKGSFWRID--PDSGAKLIDHSYKKRRQRSSQGFRPPY-----------------G 559
            ||.|.|.:|||||:|.:|  |:|              ...:|.:.||                 .
Zfish   117 KVPRPQSDPGKGSYWTMDVPPES--------------TQPRGVKRPYTDDEHVVTPFPETQLPAN 167

  Fly   560 MPRSAPVSPSHMD-------NSRESSPLQDIVLQSAPGSPGMSLEQRAADPEI-----------I 606
            .|...|..|....       ..|.:.|    |..|.|.:|       .|||.:           :
Zfish   168 QPEPLPPQPDTKSTFPPPPCKQRPAIP----VPSSLPSNP-------HADPPLRFSFADLNLPDL 221

  Fly   607 YNSQNA--HQQQQQQQQQQQQQTLSNNSNQYSSGSPYYVTNQSSGVATP 653
            |||..:  ...:::...|....||..            :|:.|:.:.||
Zfish   222 YNSFQSLCRSMREKVTSQSDVSTLLG------------LTHDSTPLHTP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/88 (53%)
foxj2XP_686801.4 Forkhead 57..134 CDD:278670 44/77 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.