DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxd1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:175 Identity:68/175 - (38%)
Similarity:90/175 - (51%) Gaps:25/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
            ||||||..||..||..:|.|:||||.|..||...:|||| |....||||||||||||..|:|:.|
 Frog    68 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYR-EKFPAWQNSIRHNLSLNDCFVKIPR 131

  Fly   518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPV----SPSHMDNSRESS 578
            ....||||::|.:||:|.....:.|:.:||:|..:         :.||.    .|.|.       
 Frog   132 EPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKR---------QQAPELVLREPGHF------- 180

  Fly   579 PLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQ 623
             |........|.|....::.:...|   :::..|.||||||.:||
 Frog   181 -LPASAYSYGPYSCAYGIQLQPFHP---HSALIAFQQQQQQARQQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Forkhead 68..153 CDD:365978 47/85 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.