DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxc1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001007864.1 Gene:foxc1 / 493250 XenbaseID:XB-GENE-479055 Length:495 Species:Xenopus tropicalis


Alignment Length:457 Identity:124/457 - (27%)
Similarity:176/457 - (38%) Gaps:170/457 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 AGAAAHLIAGDGPGIYSPLKI-SIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNY 431
            |.|||....|...|:.:|:.: |.|..||..     .|...|..  |.:|     |.||      
 Frog    28 AAAAAAAAGGGYTGMAAPMSMYSHPAHEQYQ-----AGMARAYG--PYTP-----QPQP------ 74

  Fly   432 GNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNK 496
                 :|:.            ||||||..||..||..||:|::||:|||.||::.:|:|| :..:
 Frog    75 -----KDMV------------KPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYR-DNKQ 121

  Fly   497 GWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMP 561
            |||||||||||||..|:||.|...:|||||:|.:||||.....:.|:.:||:|..:         
 Frog   122 GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKK--------- 177

  Fly   562 RSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQ 626
                               :|:|..:........|::.       :.||.|..|||:||||.|.|
 Frog   178 -------------------KDVVKDATKEDKDRLLKEH-------HGSQPAAAQQQRQQQQGQAQ 216

  Fly   627 ------------------------------TLS--------NNSNQYSSGSPYYV-TNQSSGVAT 652
                                          .||        ::|:..|||||:.: :|:|..:..
 Frog   217 AEQDSGSQPVRIQDIKTENGTSSPPQAMSPALSTVPKIESPDSSSSMSSGSPHSIPSNRSMSLEA 281

  Fly   653 PQTH-------------VEGSAASGGGGGGGVG----ALLALKRNHV------------------ 682
            .::|             |:....|..|...|.|    .|::..|..:                  
 Frog   282 AESHHPHQQHHHSQGFSVDNIMTSLRGSPQGSGELPSPLISSSRTGIAPSSLLTYSPGQGSIYSP 346

  Fly   683 -------MGGGASQHTLH-QQQAVAQQQHSEIIYEELPTDYSGHIEASEEECVTTATDATVAKRP 739
                   .||||.  |.| ..||::       :|.   .|.|||:..:.....||..|..    |
 Frog   347 PCSQGTSSGGGAG--TYHCNMQAMS-------LYS---GDRSGHLTPANTPAATTVEDTL----P 395

  Fly   740 KY 741
            .|
 Frog   396 DY 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 50/86 (58%)
foxc1NP_001007864.1 Forkhead 79..164 CDD:365978 50/85 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..322 32/181 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.