DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and fd96Cb

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:107 Identity:51/107 - (47%)
Similarity:67/107 - (62%) Gaps:2/107 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 PSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507
            |...||. ::||||||..|...||..:|.:.|.||.||.||:..:|:|||.|.| ||||:|||||
  Fly     4 PLKMSYG-DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQK-WQNSLRHNLS 66

  Fly   508 LNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR 549
            .|..||||.|:..:.||||:|.:.|.:.....:.|..:||:|
  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 44/86 (51%)
fd96CbNP_524496.1 FH 13..101 CDD:214627 44/88 (50%)
Alpha_kinase 106..>194 CDD:295997 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445545
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.