DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and fd96Cb

DIOPT Version :10

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:107 Identity:51/107 - (47%)
Similarity:67/107 - (62%) Gaps:2/107 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 PSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507
            |...||. ::||||||..|...||..:|.:.|.||.||.||:..:|:|||.|.| ||||:|||||
  Fly     4 PLKMSYG-DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQK-WQNSLRHNLS 66

  Fly   508 LNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR 549
            .|..||||.|:..:.||||:|.:.|.:.....:.|..:||:|
  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA_FOXK 151..252 CDD:438740
FH_FOXK 453..531 CDD:410800 43/77 (56%)
fd96CbNP_524496.1 FH_FOX 1..110 CDD:469596 51/107 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.