DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxo

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster


Alignment Length:483 Identity:118/483 - (24%)
Similarity:178/483 - (36%) Gaps:168/483 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 GAAAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGN 433
            |.|...:.||     .||.:....:           |.:.:|:.|....:.|::......:...:
  Fly    18 GLAMDQLGGD-----LPLDVGFEPQ-----------TRARSNTWPCPRPENFVEPTDELDSTKAS 66

  Fly   434 N------NTQDLFQTPSTASYNHNEKPPY---SYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPY 489
            |      ::|...|..:.|..|.:.:..:   |||.||..||.:|.||:||||.||.::|::.||
  Fly    67 NQQLAPGDSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPY 131

  Fly   490 YR----KETNKGWQNSIRHNLSLNRYFIKVARSQDE-PGKGSFWRIDPDS---------GAKLID 540
            ::    ..::.||:|||||||||:..|::|   |:| .||.|:|.::|::         .|.:..
  Fly   132 FKDKGDSNSSAGWKNSIRHNLSLHNRFMRV---QNEGTGKSSWWMLNPEAKPGKSVRRRAASMET 193

  Fly   541 HSYKKRRQRSSQ-----------GFRPPYGMPRSA--------PVSPSHMDNSRESSP------- 579
            ..|:|||.|:.:           |.......|.|:        |.||.|.....:.||       
  Fly   194 SRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGGFQLSPDFRQRAS 258

  Fly   580 -------------LQDIVLQSAPGSP------------GMSLEQ---RAADPEIIYNSQN----- 611
                         .||  |:...|.|            ..:||:   ..||...:.|.|.     
  Fly   259 SNASSCGRLSPIRAQD--LEPDWGFPVDYQNTTMTQAHAQALEELTGTMADELTLCNQQQQGFSA 321

  Fly   612 ----------------AHQQQQQQQQQQQQQTLSNNSNQYSS----------------------- 637
                            .|||.|||||||....|:..::.|::                       
  Fly   322 ASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNGPASGYNTLQPQSQCLLHRSLNCSCMHNARD 386

  Fly   638 G-SPYYVTNQSSGVATPQTHVEGSAASGGGGGGGVGALLALKRNHVMGGGASQHTLHQQQAVAQQ 701
            | ||..||...| .|.|.:  |.|:.|           |....|.|:.|.|....|..||...||
  Fly   387 GLSPNSVTTTMS-PAYPNS--EPSSDS-----------LNTYSNVVLDGPADTAALMVQQQQQQQ 437

  Fly   702 QHSEIIYEELPTDYSGHIEASEEECVTT 729
            |..::         |..:|  :..|.:|
  Fly   438 QQQQL---------SASLE--DNNCAST 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 40/103 (39%)
foxoNP_001262557.1 FH 95..175 CDD:238016 38/82 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.