DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxc2

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_998857.1 Gene:foxc2 / 407875 XenbaseID:XB-GENE-481382 Length:463 Species:Xenopus tropicalis


Alignment Length:418 Identity:112/418 - (26%)
Similarity:159/418 - (38%) Gaps:117/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 PYLSPTGTISAAN-----SCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNE----- 452
            ||||......||.     :.|.|......|..|....:||              .|:|::     
 Frog    17 PYLSEQNYYRAAGTYGSMATPMSVYPAHEQYTPGMARSYG--------------PYHHHQPAAPK 67

  Fly   453 ---KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIK 514
               ||||||..||..||..||||::||:|||.||:..:|:|| |..:|||||||||||||..|:|
 Frog    68 DLVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYR-ENKQGWQNSIRHNLSLNECFVK 131

  Fly   515 VARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR-------------------SSQGFRPPYGM 560
            |.|...:|||||:|.:||||.....:.|:.:||:|                   ..||..|...:
 Frog   132 VPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSREKEDRILKDQGKVQGPIPSLEL 196

  Fly   561 PR---------SAPVSP--SHMDNSRESSPLQDIVLQSAPGS----PGMSLEQRAADPEIIYNS- 609
            |:         .:|..|  :.::|   .||.....:|.:|.|    |.:|.|....|.....|. 
 Frog   197 PKHDKKIVIKSESPELPVITKVEN---LSPDGGSAMQDSPRSVASTPSVSTENSIPDQHPASNGF 258

  Fly   610 ---------------------------------QNAHQQQQQQQQQQQQQTLSNNSNQYSS--GS 639
                                             .|..|.|.....|...|::..:.:...|  ..
 Frog   259 SVENIMTLRTSPHGDLSPVPAVPCRTGMVPSLPINYTQTQSSVYSQACTQSMDTSGSYQCSMRAM 323

  Fly   640 PYYVTNQSSGVATPQTHVEGSAASGGGGGGGVGALLALKRNHVMGGGASQHTL----HQQQAVAQ 700
            ..|..::.|.:..|.|..|.::....|....:.:         |..|:.|.::    |.||....
 Frog   324 SLYTGDRPSHMCAPSTLEEATSDHHNGTASPLNS---------MSLGSGQESVLTSSHHQQTATG 379

  Fly   701 QQHSEIIYEELPTD---YSGHIEASEEE 725
            .|.:...|.....|   .|||...|:::
 Frog   380 GQTAAPWYLNPGADISHLSGHNFGSQQQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 52/86 (60%)
foxc2NP_998857.1 Forkhead 71..156 CDD:306709 52/85 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.