DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxq1b

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_998072.1 Gene:foxq1b / 405843 ZFINID:ZDB-GENE-040426-2090 Length:283 Species:Danio rerio


Alignment Length:237 Identity:69/237 - (29%)
Similarity:103/237 - (43%) Gaps:33/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 YNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYF 512
            |....||||||..||..||..:...:|||:.|..:::|.:|::| .:..||:||:|||||||..|
Zfish    40 YTRRPKPPYSYIALIAMAIRDSNTGRLTLAEINEYLMKKFPFFR-GSYTGWRNSVRHNLSLNDCF 103

  Fly   513 IKVARSQDEP-GKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRE 576
            :||.|....| ||.::|.::|.|.....|..:::||:|.|:........|...|...|.:....|
Zfish   104 LKVLRDPSRPWGKDNYWMLNPHSEYTFADGVFRRRRKRISKKILGSAESPERVPADDSRLPARDE 168

  Fly   577 SSP--LQDIVLQSAPGSPGMSLEQRAAD-------------PEIIYNSQNAHQQQQQQQQQQQQQ 626
            |..  .....:.|....|.|..||...|             |..:..:.....|.:.|.      
Zfish   169 SVSKFSSSFAIDSILSKPFMRREQSTDDTCFGTTRLMMSAAPHFLPVAMGFPPQSRFQV------ 227

  Fly   627 TLSNNSNQYSSGSPYYVTNQS-----SGVATPQTHVEGSAAS 663
                 |::.|:..|.|..|.:     |.:|..|:.:.|.|.|
Zfish   228 -----SSEVSNVFPIYRCNTADISNISRMADIQSSLPGLAHS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 38/87 (44%)
foxq1bNP_998072.1 FH 45..134 CDD:214627 39/89 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.