DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxl1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:289 Identity:88/289 - (30%)
Similarity:126/289 - (43%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVA 516
            :||||||..||..||..||||:.||||||.||:..:|||. :..:|||||||||||||..||||.
Zfish    51 QKPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYH-DNKQGWQNSIRHNLSLNDCFIKVP 114

  Fly   517 RSQDEPGKGSFWRIDPDSGAKLID------HSYKKRRQRSSQGFRPPYGMPRSAPVS-PSHMD-N 573
            |.:..|||||:|.:|    .|.:|      :..:||:.|:........|..|:...| ..|.. .
Zfish   115 REKGRPGKGSYWTLD----TKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTRVTSFKLHQGAQ 175

  Fly   574 SRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSG 638
            |.:.|||:.        :||..:::::.|               .|.|.:::...|.::..:...
Zfish   176 SEKVSPLKQ--------NPGRDIKEKSND---------------TQPQNEEENVASESAKDWCLA 217

  Fly   639 SPYYVTN--------QSSGVAT--PQTHVEGSAAS----------GGGGGG-------------- 669
            |...:.:        :||.|:|  ..||...|:||          |....|              
Zfish   218 SSTTIVSLPRCTTPERSSTVSTVAVNTHTPLSSASETRVPVKSDTGRAQSGDAKSKESNPRKTTD 282

  Fly   670 -----GVGALLALKRNH-----VMGGGAS 688
                 .:.::|:.|.|.     ...||||
Zfish   283 KAKEFSIDSILSKKENQFQRRCAAAGGAS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 51/86 (59%)
foxl1NP_957278.1 FH 52..140 CDD:214627 52/92 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.