DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxi3b

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_944600.1 Gene:foxi3b / 387258 ZFINID:ZDB-GENE-031126-4 Length:383 Species:Danio rerio


Alignment Length:299 Identity:87/299 - (29%)
Similarity:131/299 - (43%) Gaps:73/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 QQQPHLQQQQHPHHPPAHHLPLQQQQQQQQPAHHPLPHTPHHPLHHTALHQQQQRSGSIVVAPPA 368
            |:.|.|......::||    |.....|:..|:.:.|                    |....:.| 
Zfish    23 QEPPELSLYSDSYYPP----PSLPSPQRTNPSSYEL--------------------GDYAASSP- 62

  Fly   369 GAAAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNY-- 431
               ...:..:.||:.|            :|||..|       ..||.|  .|:   |.:|...  
Zfish    63 ---NPYLWFNSPGMNS------------APYLGGT-------PGPAGP--SFV---PQHYGMQRP 100

  Fly   432 --------GNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYP 488
                    |.......|..||........:|||||:.||..||..||:::||||.||.::..::|
Zfish   101 YLGPGPPGGPGGELSWFSMPSQEDLMKLVRPPYSYSALIAMAIHGAPERRLTLSQIYQYVADNFP 165

  Fly   489 YYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDH-SYKKRRQRSSQ 552
            :|.| :..|||||||||||||..|.||.|.:|:||||::|.:||:. .|:.|: :::::|:|.|.
Zfish   166 FYNK-SKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNC-EKMFDNGNFRRKRKRKSD 228

  Fly   553 GFRPPYGMPR--SAPVSPSHMDNSRESSPLQDIVLQSAP 589
                  .:|.  |:..:.|...|.|.|...|.|.:.::|
Zfish   229 ------SLPEKSSSGGNESGDSNGRGSPKSQSIDISTSP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
foxi3bNP_944600.1 FH 130..218 CDD:214627 47/89 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.