DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxi3a

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_944599.2 Gene:foxi3a / 387257 ZFINID:ZDB-GENE-031126-3 Length:353 Species:Danio rerio


Alignment Length:335 Identity:99/335 - (29%)
Similarity:151/335 - (45%) Gaps:63/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 GPGIYSPLKISIPKK-------------EQKSPYLSPTGT-ISAANSCPASPRQ-GFIQNQPNNY 428
            |...||...:..|::             :..:|||...|. :|.|......|:. |..:......
Zfish    27 GDNFYSAQHVPSPQQTLPSAYDFGEYAGQTSNPYLWFNGPGLSPAPCLTTGPQHYGMAKQYVGAS 91

  Fly   429 NNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKE 493
            ...|:......|..||........:|||||:.||..||..||:::||||.||.::..::|:|.| 
Zfish    92 GIGGSEGAFSWFSLPSQEDLMKLVRPPYSYSALIAMAIHGAPNRRLTLSQIYQYVADNFPFYNK- 155

  Fly   494 TNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDH-SYKKRRQRSSQGFRPP 557
            :...||||||||||||..|:||.|...:||||::|.:||:. .|:.|: :::::|:|.|......
Zfish   156 SKASWQNSIRHNLSLNDCFMKVPRDDSDPGKGNYWTLDPNC-EKMFDNGNFRRKRKRKSDSLAEE 219

  Fly   558 YG-------MPRSAPVSPSHMDNS-RESSPLQ---------------DIVLQS----APGSPGMS 595
            .|       ...|:|.:||  |:| |.:||:.               |:...|    .|....:.
Zfish   220 EGKGYSGSDSALSSPKNPS--DSSERGNSPISTDQAPCLNSFLNQMGDVASGSREALLPSPLAVP 282

  Fly   596 LEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSG------SPY----YVTNQSSGV 650
            |.||:: |..:|.|.:.:....|.:.|..|.::|  |..|..|      :||    |....||.:
Zfish   283 LSQRSS-PTGVYGSYSPNATMPQWETQIPQSSIS--STPYKDGYSDSMLNPYSSQLYPVLGSSDL 344

  Fly   651 ATPQTHVEGS 660
            ..|:   |||
Zfish   345 LYPR---EGS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 44/86 (51%)
foxi3aNP_944599.2 FH 116..204 CDD:214627 45/89 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.