DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxl3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:220 Identity:67/220 - (30%)
Similarity:103/220 - (46%) Gaps:41/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 YNNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRK 492
            ||.:  |:..|.:...|:.......:|.|||..||..||..:|..::||||||.||::.:|||| 
Mouse     9 YNCF--NDDADDYPAGSSDEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYR- 70

  Fly   493 ETNKGWQNSIRHNLSLNRYFIKVARSQ-DEPGKGSFWRIDPDSGA--KLID----HSYKKRRQR- 549
            ...:.||||||||||||..|:||.|:: ::.|||::|..   :|.  .|:|    .::::||:| 
Mouse    71 ANQRAWQNSIRHNLSLNSCFVKVPRTEGNDKGKGNYWTF---AGGCESLLDLFENGNFRRRRRRR 132

  Fly   550 -----SSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQ--------DIVLQSAPGSPGMSLEQRAA 601
                 .:.|...|.......|.|....|:..::||..        |.:|.|....|.:       
Mouse   133 GPKREEAPGPLEPTARGSPGPDSAQAPDHEAQASPTTHRDIKFSIDYILSSPDPFPTL------- 190

  Fly   602 DPEIIYNSQNAHQQQQQQQQQQQQQ 626
                   ..:.|.|:.:....:.||
Mouse   191 -------RSSCHSQEARYPALEPQQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 43/89 (48%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 43/89 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.