DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxi1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:419 Identity:122/419 - (29%)
Similarity:171/419 - (40%) Gaps:144/419 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 QQPHLQQQQHPHHPPAHHLPLQQQ-------------QQQQQPAHHPLPHTPHHPLHHTALHQQQ 356
            |||..||..          |||||             ...||..||      ||..||   ||: 
Zfish    14 QQPSSQQTS----------PLQQQDILDMTVYCDSNFSMYQQNLHH------HHHHHH---HQR- 58

  Fly   357 QRSGSIVVAPPAGAAAHLIAGDGPGIYSPLKISIPKKEQKSPYL---SPTGTISAANSCP--ASP 416
                     |||..:::     |.|.||        ....:|||   ||     ...|.|  :||
Zfish    59 ---------PPAHPSSY-----GLGEYS--------SPSTNPYLWMNSP-----GITSTPYLSSP 96

  Fly   417 RQG-FIQNQPNNYNNYGNNNTQDLFQTPSTA---------SYNHNE------KPPYSYAQLIVQA 465
            ..| :||      :.:|:|..|  |..|.|.         |.:..:      :|||||:.||..|
Zfish    97 NGGSYIQ------SGFGSNQRQ--FLPPPTGFGSADLGWLSISSQQELFKMVRPPYSYSALIAMA 153

  Fly   466 ISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRI 530
            |..|.||:||||.||.::..::|:|:| :..|||||||||||||..|.||||.:|:||||::|.:
Zfish   154 IQNAQDKKLTLSQIYQYVADNFPFYKK-SKAGWQNSIRHNLSLNDCFKKVARDEDDPGKGNYWTL 217

  Fly   531 DPDSGAKLIDH-SYKKRRQRSSQG----------------------------FRPPYGMPRSAPV 566
            ||:. .|:.|: :::::|:|.:.|                            ..|....|:|:| 
Zfish   218 DPNC-EKMFDNGNFRRKRKRRADGNAMSVKSEDALKLADTSSLMSASQPSLQNSPTSSDPKSSP- 280

  Fly   567 SPSHMDNSRESSP------------LQDIVLQSAPGSP---GMSLEQRAADPEIIYNSQNAHQQQ 616
            ||     |.|.||            :....::|..||.   |...:...:..||...|:..|...
Zfish   281 SP-----SAEHSPCFSNFIGNMNSIMSGNAVRSRDGSSAHLGDFTQHGMSGHEISPPSEPGHLNT 340

  Fly   617 QQQQQQQQQQTLSNNSNQYSSGSPYYVTN 645
            .:........   |||...:|.|.::..|
Zfish   341 NRLNYYSASH---NNSGLINSISNHFSVN 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 48/86 (56%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 48/87 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.