DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and CG32006

DIOPT Version :10

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster


Alignment Length:69 Identity:16/69 - (23%)
Similarity:29/69 - (42%) Gaps:10/69 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LEIDFLAQASKNLSERSPFDVPEDGSTSVLSVPTLPIALANLLKNHSDNKKRHKKSHSGADKKKK 112
            |.|:.|...:..:|:.||          .|..|.:.|.|...::...:|:::...|.|......:
  Fly   214 LLIELLETLNALISKISP----------CLLFPIVTIFLIKEIRKADENRRKISSSSSAKTSDSR 268

  Fly   113 KSSR 116
            |:||
  Fly   269 KTSR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA_FOXK 151..252 CDD:438740
FH_FOXK 453..531 CDD:410800
CG32006NP_726538.1 Forkhead 146..217 CDD:459732 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.