DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxj3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:424 Identity:113/424 - (26%)
Similarity:175/424 - (41%) Gaps:114/424 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 GIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNN-NTQDLFQTPS 444
            |:|.....|:......|...|   ::::.:..|....:..||......|.:|.. :.::....|:
  Rat     2 GLYGQACPSVTSLRMTSELES---SLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPN 63

  Fly   445 T------ASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIR 503
            |      ...:.:.|||||||.||..||:::|.|::|||.||.:|..::|||| |...||:||||
  Rat    64 TTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYR-EAGSGWKNSIR 127

  Fly   504 HNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPR------ 562
            ||||||:.|:||.||:|:|||||:|.||.:.....:. :..|:|.||.:....||.:..      
  Rat   128 HNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDTLP-TRPKKRARSVERASTPYSIDSDSLGME 191

  Fly   563 ---SAPVSP-------------------------SHMDNSRESSPLQDIVLQSA----------- 588
               |...||                         |.::||.....|..:.|.|.           
  Rat   192 CIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTN 256

  Fly   589 ---PGSPGMSLEQR------AADPEIIYNSQN--------------AHQQQQQQQ------QQQQ 624
               |.|..::.:|:      ..|.::::...|              ..:|...||      .:..
  Rat   257 HPEPVSQSLTPQQQPQYNLPERDKQLLFTEYNFEDLSASFRSLYKSVFEQSLSQQGLMSIPSESS 321

  Fly   625 QQTLSNNSNQYSSGS-----PYYVTNQSSGVATPQTHVEGSAASGGGGGGGVGALLALKRNHVMG 684
            ||:.::.|.|:|..|     |:  :||||   .|..| .|.:|:|......|.  |:..:.|.. 
  Rat   322 QQSHTSCSYQHSPSSTVTSHPH--SNQSS---LPNNH-SGLSATGSNSVAQVS--LSHPQMHTQ- 377

  Fly   685 GGASQHTLHQQQAVAQ------------QQHSEI 706
              .|.||.|:...:.|            ||||::
  Rat   378 --PSPHTPHRPHGLPQHPQRPQHPASHPQQHSQL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 50/86 (58%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 82/294 (28%)
FH_FOXJ3 77..155 CDD:410826 48/78 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.