DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxs1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:231 Identity:76/231 - (32%)
Similarity:104/231 - (45%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 QTPSTAS----YNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNS 501
            |.|.||.    .....||||||..||..||.::|.::.||||||.:|:..:.:|| ....|||||
  Rat     2 QQPPTAESLAPSTEPSKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYR-HNRPGWQNS 65

  Fly   502 IRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR-----SSQGFRPPYGMP 561
            ||||||||..|:||.|...:|||||:|.:|||........|:.:||:|     .:||.:      
  Rat    66 IRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTK------ 124

  Fly   562 RSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYN---------SQNAHQQQQ 617
              .||...|.. .|.:||.|        |:|..:..:....|..:.|         |..|:....
  Rat   125 --GPVKADHRP-LRATSPDQ--------GAPNTTTGRLCPFPPEVPNPKGFGGLMGSLPANMCPT 178

  Fly   618 QQQQQQQQQTLSNNSNQYSSGSPYYVTNQSSGVATP 653
            ....:.|..|...:.....||.|..::..:|....|
  Rat   179 TSDTRPQLPTGPKDMCSAKSGGPRELSEATSPSPCP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 46/85 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.