DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxd3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_571365.2 Gene:foxd3 / 30548 ZFINID:ZDB-GENE-980526-143 Length:371 Species:Danio rerio


Alignment Length:206 Identity:70/206 - (33%)
Similarity:92/206 - (44%) Gaps:62/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
            ||||||..||..||..:|.|:||||||..||...:|||| |....||||||||||||..|:|:.|
Zfish    96 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYR-EKFPAWQNSIRHNLSLNDCFVKIPR 159

  Fly   518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR--------------------SSQGFRPPYG--- 559
            ....||||::|.:||.|.....:.|:.:||:|                    .:.|...|||   
Zfish   160 EPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQPDILRDQTALMMQSFGAYGIGNPYGRHY 224

  Fly   560 ------------------------MPRSAPVSPSHMDN----SRESSPLQDI---------VLQS 587
                                    :|.:.|:.||...|    |.:.||...:         :::|
Zfish   225 GIHPAAYTHPAALQYPYIPPVGPMLPPAVPLLPSAELNRKAFSSQLSPSLQLQLNSLSTASIIKS 289

  Fly   588 APGS-PGMSLE 597
            .|.| |..|:|
Zfish   290 EPSSRPSFSIE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 48/86 (56%)
foxd3NP_571365.2 Forkhead 96..182 CDD:278670 48/86 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.