Sequence 1: | NP_001261701.1 | Gene: | FoxK / 39252 | FlyBaseID: | FBgn0036134 | Length: | 760 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571365.2 | Gene: | foxd3 / 30548 | ZFINID: | ZDB-GENE-980526-143 | Length: | 371 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 70/206 - (33%) |
---|---|---|---|
Similarity: | 92/206 - (44%) | Gaps: | 62/206 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
Fly 518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR--------------------SSQGFRPPYG--- 559
Fly 560 ------------------------MPRSAPVSPSHMDN----SRESSPLQDI---------VLQS 587
Fly 588 APGS-PGMSLE 597 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FoxK | NP_001261701.1 | FHA | <170..253 | CDD:238017 | |
Forkhead | 453..540 | CDD:278670 | 48/86 (56%) | ||
foxd3 | NP_571365.2 | Forkhead | 96..182 | CDD:278670 | 48/86 (56%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.850 |