DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxd5

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:282 Identity:79/282 - (28%)
Similarity:123/282 - (43%) Gaps:36/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 QKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNT----QDLFQTPSTASYNHNEKPP 455
            |::|.......|.......:...:.:....|...::.|:.::    .|...:......:.:.|||
Zfish    11 QRTPISPEDDEIDIVGGDHSDSEREYFMRDPTEVDHSGSESSGESESDFASSTVAPKQSSSVKPP 75

  Fly   456 YSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQD 520
            |||..||..||..:|.|:||||||..||...:||| ||....||||||||||||..|||:.|...
Zfish    76 YSYIALITMAILQSPMKKLTLSGICDFISNKFPYY-KEKFPAWQNSIRHNLSLNDCFIKIPREPG 139

  Fly   521 EPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQG-----------FRP-----PYGMPRSAPVSPS 569
            .||||::|.:||.|.....:.|:.:||:|..:.           :.|     .||.|.....:..
Zfish   140 NPGKGNYWSLDPASEDMFDNGSFLRRRKRFKRNQPEFTKDSLVLYHPTLSYRAYGRPYCVSGAVP 204

  Fly   570 HMDNSRESSPLQDIVLQSAPGSPGMSLEQRAAD-PEIIYNSQNAHQQQQQQQQQQQ-----QQTL 628
            ...|.....|:.|.::...|.....::..:..| |||         ||:.:.:.|:     ...:
Zfish   205 AQTNPVGYLPVPDGIMVPPPFFQYQTMNIKIHDAPEI---------QQRPEHKTQRCSFSIDSIM 260

  Fly   629 SNNSNQYSSGSPYYVTNQSSGV 650
            :.::...|..|.:::|...|.|
Zfish   261 AKSTESSSKSSAHHLTPDYSFV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/86 (57%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 49/86 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.