DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxh1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_008763787.1 Gene:Foxh1 / 300054 RGDID:1311275 Length:416 Species:Rattus norvegicus


Alignment Length:408 Identity:91/408 - (22%)
Similarity:147/408 - (36%) Gaps:128/408 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 HHTALHQQQQRSGSIVVAPPAGAAAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSC 412
            |.:..||..:..    ..||..:.|.  ..|....|||..:| |:..|                 
  Rat    11 HPSPFHQNDKER----AWPPCPSMAS--GWDLASTYSPTTLS-PQLVQ----------------- 51

  Fly   413 PASPRQGFIQNQ-PNNYNNYGNNNTQDLFQTPSTAS--YNHNEKPPYSYAQLI------VQAISA 468
              :..||:|... |.:.:.......:.|.:||....  |..::||||:|..:|      |||:  
  Rat    52 --ALAQGYIPCMGPLDNSQLRPPEAESLSKTPKRRKKRYLRHDKPPYTYLAMIALIIRQVQAV-- 112

  Fly   469 APDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEP-GKGSFWRID- 531
                              :|::| :..:||::|||||||.||.|.||.:...:| .||:||.:| 
  Rat   113 ------------------FPFFR-DDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDV 158

  Fly   532 ---PDSGAKLIDHSYKKRRQR----------------SSQGFRPPYGMPRSAPVSPSHMDNSRES 577
               |....:|.:.:..:|.|.                ..|.:|||      :|..||.       
  Rat   159 SLIPAEALRLQNTALCRRWQNRGTHRAFAKDLSPYVLHGQPYRPP------SPPPPSR------- 210

  Fly   578 SPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYY 642
               :|..::|..|.||.:            ::...|.:...|....|..|||.......:| |..
  Rat   211 ---EDFSIKSLLGDPGKA------------STWPQHPRLAGQSTPAQASTLSKGEEGIGAG-PSN 259

  Fly   643 VTNQS----SGVATPQTHVEGSAASGGGGGGGVGALLALKRNHVMGGGASQHTLHQQQ------A 697
            |:::.    |.:..| |.:||..:.|           .:.|...:........||..|      .
  Rat   260 VSDKPLWPLSSLPRP-TRIEGETSQG-----------EVIRPSPVSSDQGSWPLHLLQDSSDSMG 312

  Fly   698 VAQQQHSEIIYEELPTDY 715
            ::::.....::.:|||.|
  Rat   313 MSRRGSRASLWGQLPTSY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 33/97 (34%)
Foxh1XP_008763787.1 FH 93..157 CDD:294049 30/84 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.