DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxi1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:285 Identity:83/285 - (29%)
Similarity:134/285 - (47%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 SPYLSPTGT-------ISAANSCPASPRQGFIQNQ--PNNYNNYGNNNTQDLFQTPSTASYNHNE 452
            :|||...||       :...|:.|..|:...:|.|  |:...         ....||........
  Rat    61 NPYLWLNGTAMTPPPYLPGTNASPFLPQAYGMQRQLLPSELG---------WLPIPSQEELMKLV 116

  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
            :|||||:.||..||..|||::||||.||.::..::|:|.| :..|||||||||||||..|.||.|
  Rat   117 RPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNK-SKAGWQNSIRHNLSLNDCFKKVPR 180

  Fly   518 SQDEPGKGSFWRIDPDSGAKLIDH-SYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQ 581
            .:|:||||::|.:||:. .|:.|: :::::|:|.|..               |....|..|...:
  Rat   181 DEDDPGKGNYWTLDPNC-EKMFDNGNFRRKRKRKSDA---------------SSSTGSLASEKTE 229

  Fly   582 DIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYYVTNQ 646
            :.:|.|:|         :..:|:.:.::.:             ..|.|::..:.||.:|......
  Rat   230 NRLLSSSP---------KPTEPQEVLDTAS-------------PDTTSSSPEKRSSPAPSGTPCL 272

  Fly   647 SSGVATPQTHVEG------SAASGG 665
            ::.::|...:|.|      |||:.|
  Rat   273 NNFLSTMTAYVNGTNPISRSAATPG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 48/89 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.