DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxl2

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_036150.1 Gene:Foxl2 / 26927 MGIID:1349428 Length:375 Species:Mus musculus


Alignment Length:324 Identity:94/324 - (29%)
Similarity:134/324 - (41%) Gaps:79/324 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 SIPKKEQKS-PYLSPTG--TISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNH 450
            |.|:.|..: ..|:|..  .:..|.:.|.||.:|            |....    :.|..|    
Mouse     4 SYPEPEDTAGTLLAPESGRAVKEAEASPPSPGKG------------GGTTP----EKPDPA---- 48

  Fly   451 NEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKV 515
             :||||||..||..||..:.:|:|||||||.:|:..:|:|.| ..||||||||||||||..||||
Mouse    49 -QKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEK-NKKGWQNSIRHNLSLNECFIKV 111

  Fly   516 ARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPL 580
            .|......||::|.:|| :...:.:....:||:|..:.||||          |:|....:.    
Mouse   112 PREGGGERKGNYWTLDP-ACEDMFEKGNYRRRRRMKRPFRPP----------PAHFQPGKG---- 161

  Fly   581 QDIVLQSAPGSPGMSLEQRAAD-------PEIIYNSQNAHQQQQQQQQQQQQQTLSNNS---NQY 635
               :..|...:.|..:....||       |:.:                  |....|||   .|.
Mouse   162 ---LFGSGGAAGGCGVPGAGADGYGYLAPPKYL------------------QSGFLNNSWPLPQP 205

  Fly   636 SSGSPYYVTNQSSGVATPQTHVEGSAASGGGGGGGVGALLALKRNHVMGGGASQHTLHQQQAVA 699
            .|..||.....::..|.      .:||:...|.|..||...:|  .:.|..||.....:.|::|
Mouse   206 PSPMPYASCQMAAAAAA------AAAAAAAAGPGSPGAAAVVK--GLAGPAASYGPYSRVQSMA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
Foxl2NP_036150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 13/66 (20%)
FH 50..138 CDD:214627 46/89 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.