DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and sep1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_596301.1 Gene:sep1 / 2540866 PomBaseID:SPBC4C3.12 Length:663 Species:Schizosaccharomyces pombe


Alignment Length:235 Identity:77/235 - (32%)
Similarity:112/235 - (47%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 LFQTPSTASYNHNE------------KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYR 491
            :::.||.:|....|            |||||||.||..:|..:||::||||.||.:|...:.:|.
pombe   102 IYRNPSVSSSQSQEPEEFFLPLDDGKKPPYSYAMLIGMSIIRSPDRRLTLSAIYDWISNTFSFYN 166

  Fly   492 KETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRP 556
            | :|.|||||||||||||:.|:|:.|.::.||||.||.|.|..     :..:.|.:.|     :|
pombe   167 K-SNNGWQNSIRHNLSLNKAFMKIERPRNLPGKGHFWSIRPGH-----EEQFLKLKLR-----KP 220

  Fly   557 PYGMPRSAPVSPSHMDNSRESSPLQDIVLQ----SAPGSPGMSLEQRAADPEIIYNSQNAHQQQQ 617
              |:            |||.:.|:||:...    |:.||.|.:....:..   |:|.::.:.|..
pombe   221 --GV------------NSRPAPPVQDVTSSTKYGSSTGSSGFNTFNTSPH---IFNQRHQYLQNY 268

  Fly   618 QQQQQQQQQTLSN----NSNQYSSGSPYYVTNQSSGVATP 653
            .........|:||    |.:...|..||..|   .|:..|
pombe   269 YTASLTNIPTISNVNATNFHPLHSQQPYVDT---PGIDAP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
sep1NP_596301.1 COG5025 20..663 CDD:227358 77/235 (33%)
Forkhead 128..214 CDD:278670 46/91 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.