DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and mei4

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_595617.1 Gene:mei4 / 2540241 PomBaseID:SPBC32H8.11 Length:517 Species:Schizosaccharomyces pombe


Alignment Length:316 Identity:85/316 - (26%)
Similarity:131/316 - (41%) Gaps:67/316 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 PLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYN 449
            |.|:.:....::|..::.:..:|..:|......:..::.: |..|...::..|.:|........:
pombe    14 PKKVILSLSLKESSKINDSQNVSNVSSKEKCETEALLREE-NKENLSSDSIRQMIFGDEMAGFVD 77

  Fly   450 HNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIK 514
            ..||||.|||.||..||..:.:|||||||||::|...:.||... :.|||||||||||||:.|||
pombe    78 TGEKPPCSYATLIGLAILQSHNKQLTLSGIYTWIRNTFRYYLNH-DGGWQNSIRHNLSLNKAFIK 141

  Fly   515 VARSQDEPGKGSFWRIDPDSGAKLI----------DHSYKKRRQRSSQGFRP------PYGMPRS 563
            |.:.:.:..||.:|.||||.....:          |.:.|||........:|      |....||
pombe   142 VEKPKGKTLKGHYWTIDPDHMQNFVSVRLHRSHSTDSNSKKRPSSKCHEIKPLTTREIPLARKRS 206

  Fly   564 -------------------APVS-----PSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPE 604
                               |.||     ||:.|:|..|:.::       |..|..:::..::..|
pombe   207 RLNSFNSSTSTSGSSSNVAAEVSNDASQPSNQDSSLNSNIVK-------PPLPPSNVQSNSSSSE 264

  Fly   605 IIYNSQNAHQQQQQQQQQQQQQTLSNNSNQ-----------------YSSGSPYYV 643
            .: ...||..|:........:.:|..|.|.                 ||...|.|:
pombe   265 NV-PKPNAETQEDLPTIDAHESSLYENVNDSRLYEVPACRNMALNTGYSDADPGYL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/96 (48%)
mei4NP_595617.1 COG5025 1..517 CDD:227358 85/316 (27%)
Forkhead 81..167 CDD:278670 46/86 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.