DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxd4

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_001055972.2 Gene:Foxd4 / 252886 RGDID:621716 Length:432 Species:Rattus norvegicus


Alignment Length:367 Identity:107/367 - (29%)
Similarity:146/367 - (39%) Gaps:93/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 TPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNL 506
            |.:||......||||||..||..||..:|.|:||||||.:||...:||||::. ..|||||||||
  Rat    92 TTTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKF-PAWQNSIRHNL 155

  Fly   507 SLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPR--------- 562
            |||..|:|:.|....||||::|.:||.|.....:.|:.:||:|..:...||.|.|.         
  Rat   156 SLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPPPGGHPHCPFPPPAVP 220

  Fly   563 --------------SAP------VSPSHMDNSRESSPLQD----IVLQSAPGSPGMSLEQRAADP 603
                          |||      |.|:....||..:||..    .:|.:||.......:...|||
  Rat   221 ATVQVSQPGLLLRYSAPPQPNLAVHPASPPRSRPCAPLHPYPLRYLLLAAPAYADEPRKAEGADP 285

  Fly   604 EIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYYVTNQSSGVA--------TPQTHVEGS 660
                                 ..:|:..:.|.:.||..:..:|.||..        |.::.::| 
  Rat   286 ---------------------ATSLAIPALQPAPGSQPWEGDQGSGSRSRRGCASFTIESIMQG- 328

  Fly   661 AASGGGGGGGVG----------------ALL----ALKRNHVMGGGASQHTLHQQQ---AVAQQQ 702
             .:|||.|....                .||    |....||  ..||:..|.|||   ...||:
  Rat   329 -VTGGGTGSAQSPPFAPWSYCHLLQHPPCLLHPQAASPLFHV--PAASRTVLQQQQPRPPPXQQE 390

  Fly   703 HSEIIYEELP---TDYSGHIEASEEECVTTATDATVAKRPKY 741
            .........|   .....|:.|||:..:||.........|.:
  Rat   391 EHHCAIRCSPGKGKRLGRHLSASEDXRLTTXLSGREGTLPAF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
Foxd4XP_001055972.2 Forkhead 103..189 CDD:278670 47/86 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.