DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxi3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:401 Identity:116/401 - (28%)
Similarity:160/401 - (39%) Gaps:107/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 QPAHHP-LPHTPHHPLHHTALHQQQQRSGSIVVAPPAGAAAHLIAGDGPGIYSPLKISI------ 390
            |||..| .|.|...|.           ..|...||||.||...:..:|||:..|...:.      
Mouse    13 QPAAAPGAPPTSRAPY-----------GLSDYAAPPAAAANPYLWLNGPGVGGPASAASYLGAPP 66

  Fly   391 -PKKEQKSPYLSP---TGTISAAN--------SCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTP 443
             |......|:|.|   .||.:.|.        |.||||..   ...|.........:.:||.:. 
Mouse    67 PPPGAAPGPFLQPPAAPGTFAGAQRGFAQPSASAPASPAG---SAAPGELGWLSMASREDLMKM- 127

  Fly   444 STASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSL 508
                    .:|||||:.||..||.:||:::||||.||.|:..::|:|:: :..||||||||||||
Mouse   128 --------VRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQR-SKAGWQNSIRHNLSL 183

  Fly   509 NRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHS--YKKRRQR--SSQGFRPPYGMPRS------ 563
            |..|.||.|.:|:||||::|.:||:. .|:.|:.  .:|||:|  :|.....|.|..:|      
Mouse   184 NDCFKKVPRDEDDPGKGNYWTLDPNC-EKMFDNGNFRRKRRRRAEASSNLTVPSGTSKSEGQSSR 247

  Fly   564 ----------APVS---PSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEI-----IYNSQ 610
                      :|.|   ||......|.:       :|...|||.|  ...:.|.:     .:|:.
Mouse   248 LRVSGKLEGDSPSSILRPSQSPEPPEGT-------KSTASSPGAS--TLTSTPCLNTFLSTFNTL 303

  Fly   611 NAHQQQQQQQQ-------------QQQQQTLSNNSNQYSSGSPYYV-----TNQSSGVATPQTHV 657
            |.:.......|             |....|..|.|...||.....:     :||.|....|    
Mouse   304 NVNSSSSMGNQRTLPGSRRHLGGTQLPSSTFPNTSVPDSSPDSMQLSTVGGSNQLSSYYNP---- 364

  Fly   658 EGSAASGGGGG 668
                .|||..|
Mouse   365 ----FSGGSSG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 46/87 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.