DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and FOXS1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_004109.1 Gene:FOXS1 / 2307 HGNCID:3735 Length:330 Species:Homo sapiens


Alignment Length:156 Identity:60/156 - (38%)
Similarity:83/156 - (53%) Gaps:23/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
            ||||||..||..||.::|.::.||||||.:|:..:.:|| ....|||||||||||||..|:||.|
Human    18 KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYR-HNRPGWQNSIRHNLSLNECFVKVPR 81

  Fly   518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR-----SSQGFRPPYGMPRSAPVSPSHMDNSRES 577
            ...:|||||:|.:|||........|:.:||:|     .::|.|.| ...|..|:..:..|     
Human    82 DDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGP-AKARRGPLRATSQD----- 140

  Fly   578 SPLQDIVLQSAPGSPGMSLEQRAADP 603
                       ||.|..:..::.:.|
Human   141 -----------PGVPNATTGRQCSFP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
FOXS1NP_004109.1 Forkhead 18..103 CDD:306709 46/85 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..157 12/62 (19%)
DNA_pol3_gamma3 <116..313 CDD:331207 10/57 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.