Sequence 1: | NP_001261701.1 | Gene: | FoxK / 39252 | FlyBaseID: | FBgn0036134 | Length: | 760 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004464.2 | Gene: | FOXE1 / 2304 | HGNCID: | 3806 | Length: | 373 | Species: | Homo sapiens |
Alignment Length: | 337 | Identity: | 89/337 - (26%) |
---|---|---|---|
Similarity: | 121/337 - (35%) | Gaps: | 118/337 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 453 KPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVAR 517
Fly 518 SQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQ------------------------------ 552
Fly 553 -----------------GFRPP--------------------YGMPRSAPVSPSHMDNSRESSPL 580
Fly 581 QDIVLQSAPGSPGMSLE-QRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPY--- 641
Fly 642 ---YVTNQSSGVATPQTHVEGSAA-SGGGGGGGV---------------GALLALKRNHVMGGGA 687
Fly 688 SQHTLHQQQAVA 699 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FoxK | NP_001261701.1 | FHA | <170..253 | CDD:238017 | |
Forkhead | 453..540 | CDD:278670 | 45/86 (52%) | ||
FOXE1 | NP_004464.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 19..51 | ||
FH | 53..141 | CDD:214627 | 45/88 (51%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |