DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and FOXG1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_005240.3 Gene:FOXG1 / 2290 HGNCID:3811 Length:489 Species:Homo sapiens


Alignment Length:390 Identity:119/390 - (30%)
Similarity:167/390 - (42%) Gaps:57/390 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DELHQQQLHH--HQQQPHLQQQQHPHH--PPAHHLPLQQQQQQQQPAHHPLPHTPHHPLHHTALH 353
            |..|....||  |..|.|.....|.||  |||...|...||||..|   |.|..|..|....|..
Human    31 DNHHASHGHHNSHHPQHHHHHHHHHHHPPPPAPQPPPPPQQQQPPP---PPPPAPQPPQTRGAPA 92

  Fly   354 QQQQRSGSIVVAPPA----------GAAAHLIA-----GDGPGIYSPLKISIPKKEQKSPYLSPT 403
            ....:....::.||.          ||.|..:.     |.|||..:|:.   |.:::|.......
Human    93 ADDDKGPQQLLLPPPPPPPPAAALDGAKADGLGGKGEPGGGPGELAPVG---PDEKEKGAGAGGE 154

  Fly   404 GTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISA 468
            ....|...  ....:|..:.:..|                  ..|   ||||:||..||:.||..
Human   155 EKKGAGEG--GKDGEGGKEGEKKN------------------GKY---EKPPFSYNALIMMAIRQ 196

  Fly   469 APDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPD 533
            :|:|:|||:|||.||:|::|||| |..:|||||||||||||:.|:||.|..|:||||::|.:||.
Human   197 SPEKRLTLNGIYEFIMKNFPYYR-ENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPS 260

  Fly   534 SGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQ 598
            |....|..:..|.|:||:.. |......|.|.::.:.:.....:..|.      .|.||.:||..
Human   261 SDDVFIGGTTGKLRRRSTTS-RAKLAFKRGARLTSTGLTFMDRAGSLY------WPMSPFLSLHH 318

  Fly   599 RAADPEIIYN-SQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYYVTNQSSGVATPQTHVEGSAA 662
            ..|...:.|| :.:|:............|....|::.:|:.:...|....:|.....||...:||
Human   319 PRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAA 383

  Fly   663  662
            Human   384  383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 51/86 (59%)
FOXG1NP_005240.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..181 40/178 (22%)
FH_FOXG 181..259 CDD:410795 48/78 (62%)
COG5025 <184..>356 CDD:227358 68/179 (38%)
Required for interaction with TLE6. /evidence=ECO:0000250|UniProtKB:Q60987 249..344 26/101 (26%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 383..406 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 427..455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.