DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and FOXD4L1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_036316.1 Gene:FOXD4L1 / 200350 HGNCID:18521 Length:408 Species:Homo sapiens


Alignment Length:309 Identity:90/309 - (29%)
Similarity:131/309 - (42%) Gaps:77/309 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 ASPRQGFIQNQPNNYNNYGNNNTQDLFQTP---STASYNHNE--KPPYSYAQLIVQAISAAPDKQ 473
            |.||:......|::.:.:|..     |:.|   :.||.:..:  ||||||..||..||..:|.|:
Human    68 ALPREHIEGGGPSDPSEFGTE-----FRAPPRSAAASEDARQPAKPPYSYIALITMAILQSPHKR 127

  Fly   474 LTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKL 538
            ||||||.:||...:||||::. ..||||||||||||..|:|:.|....||||::|.:||.|....
Human   128 LTLSGICAFISGRFPYYRRKF-PAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMF 191

  Fly   539 IDHSYKKRRQR-SSQGFRPPYGMPRSAPVSPSH--MDNSRES---------SPLQDIVLQSAPGS 591
            .:.|:.:||:| ......|...:|...|:..:|  :.|.|..         .|:......:|||.
Human   192 DNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPALPQPVPGAYPNTAPGR 256

  Fly   592 PGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYYVTNQSSGVATPQT- 655
            ...:| .....|..:..|..|:                       :|:|...  :.:.:|||.| 
Human   257 RPYAL-LHPHPPRYLLLSAPAY-----------------------AGAPKKA--EGADLATPGTL 295

  Fly   656 -------------HVEGSAASGGGG--------------GGGVGALLAL 677
                         ..:|.|:..|||              |.|.||..:|
Human   296 PVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
FOXD4L1NP_036316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..104 7/37 (19%)
Forkhead 107..193 CDD:278670 47/86 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.