DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and fkh-2

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_508644.1 Gene:fkh-2 / 180663 WormBaseID:WBGene00001434 Length:270 Species:Caenorhabditis elegans


Alignment Length:250 Identity:81/250 - (32%)
Similarity:120/250 - (48%) Gaps:79/250 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 TISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAA 469
            |:|..:..|:|                  :|:::  :|||:.    |:|||:||..||:.||..:
 Worm    69 TLSKDSKSPSS------------------SNSEE--KTPSSP----NDKPPFSYNALIMMAIKDS 109

  Fly   470 PDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRID--- 531
            |:|:|||:|||.:||.:||:|| :..:|||||||||||||:.|:||.|:.|:||||::|.:|   
 Worm   110 PEKRLTLAGIYEYIVTNYPFYR-DNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATA 173

  Fly   532 ----------------PDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSH----MDNS-- 574
                            |.|.::....:||:....::..|  ||..| ..|..|.|    ..|.  
 Worm   174 EDEVFIGGATGKLRRRPSSLSRARMDAYKQYGAAAANLF--PYFSP-GMPALPRHPYLTAPNGFL 235

  Fly   575 -RESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTL 628
             |:..|:        |..|     |..|.||::            |....|||:|
 Worm   236 PRQMMPI--------PAMP-----QVFAQPELL------------QLYINQQQSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/105 (47%)
fkh-2NP_508644.1 FH 93..170 CDD:238016 46/77 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.