DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and pha-4

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001041114.1 Gene:pha-4 / 180357 WormBaseID:WBGene00004013 Length:506 Species:Caenorhabditis elegans


Alignment Length:442 Identity:111/442 - (25%)
Similarity:165/442 - (37%) Gaps:129/442 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PSTEIRIEFESYVPAT------SSDAIDGHSPSLVV----------------GGGGGVAGGGAHV 285
            |.:|...|.|   |||      |.|:::..:..|:.                |...|.:..|..|
 Worm    20 PESEPDSEAE---PATTTNSTDSEDSVEQENKKLLETEKNRKREQKHKMLPNGTTSGTSDTGNQV 81

  Fly   286 IITPLPRDELHQQQLHHHQQQPHLQQQQHPHHPPAHHLPLQQQQQQQQPAHHPLPHTPHHPLHHT 350
            ..|......:....::   .|.:|        |...:..|..|..|.|.|.:.|.:..::..:.|
 Worm    82 PATSSAASSVDYTAMN---AQDYL--------PTYSNTTLNYQPYQYQTAANGLLNYNNYSQYAT 135

  Fly   351 ALHQQQQRSGSIVVAPPAGAAAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPAS 415
            |     .:.||..::|     |:.:.|.|   .|||..:          ...||..:||.|...|
 Worm   136 A-----NQLGSNYISP-----ANFMQGGG---ISPLGFT----------TGTTGATTAAASVATS 177

  Fly   416 PRQGFIQNQ-------------PNNYNNYGNNNTQDL----FQTPSTASYNH----NEKPPYSYA 459
            .....|...             ..:|:.......|:|    |:|.:.....|    ..||||||.
 Worm   178 SASAVIGRSNGRSSSTVAASPADRSYSGVSGGQGQELTIQEFETVTEKIRRHGTYGQSKPPYSYI 242

  Fly   460 QLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGK 524
            .||..||..:..:|||||.||::|:..:|||:....: |||||||:||.|..|:|||||.|:|||
 Worm   243 SLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQR-WQNSIRHSLSFNDCFVKVARSPDKPGK 306

  Fly   525 GSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAP 589
            ||||.:....|....:..|.:|::|.....|.|....|:|                         
 Worm   307 GSFWTLHEHCGNMFENGCYLRRQKRFKVKEREPSRKKRNA------------------------- 346

  Fly   590 GSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQ-----TLSNNSNQYS 636
                              |||..||||...:.:.:::     |.:::...||
 Worm   347 ------------------NSQQLHQQQHIPKMEIKEEDPTSITTTSSLGAYS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017 3/9 (33%)
Forkhead 453..540 CDD:278670 46/86 (53%)
pha-4NP_001041114.1 FH 236..324 CDD:214627 46/88 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I3168
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.