DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxe3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:239 Identity:77/239 - (32%)
Similarity:107/239 - (44%) Gaps:61/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 PAGAAAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANS-CPASPRQGFIQNQPNNYNN 430
            |:|.....:|||.||                  ..|...:...:| .||:|..|..:.:|     
  Rat    18 PSGPQPPSLAGDEPG------------------REPEEVVGGGDSEPPAAPGPGRRRRRP----- 59

  Fly   431 YGNNNTQDLFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETN 495
                              ....||||||..||..|::.||.::|||:.||.||.:.:.:||....
  Rat    60 ------------------LQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPR 106

  Fly   496 KGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDH-SYKKRRQRSSQGFRP--- 556
            | |||||||||:||..|:||.|....||||::|.:|| :.|.:.|: |:.:||:|..:...|   
  Rat   107 K-WQNSIRHNLTLNDCFVKVPREPGNPGKGNYWTLDP-AAADMFDNGSFLRRRKRFKRTELPAPP 169

  Fly   557 ----PYG----MPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSP 592
                ||.    .|..||..|:.:  .|..|.|.   ||:.|..|
  Rat   170 PPPFPYAPFPPAPAPAPAPPARL--FRLDSLLG---LQTEPPGP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 44/86 (51%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 14/84 (17%)
FH 64..152 CDD:214627 45/89 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.