DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxq1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_032265.3 Gene:Foxq1 / 15220 MGIID:1298228 Length:400 Species:Mus musculus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:118/259 - (45%) Gaps:58/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 AAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTIS-------AANSCPASPRQGFIQNQPNNY 428
            |||   ||..|  |.|: .....:..|| ||..|..|       ||||..|....|.::......
Mouse    10 AAH---GDKMG--SDLE-GAGSSDVPSP-LSAAGDDSLGSDGDCAANSPAAGSGAGDLEGGGGER 67

  Fly   429 NNYGNNNTQ------DLFQTPSTAS-----------------YNHNEKPPYSYAQLIVQAISAAP 470
            |:.|..:.|      |..:|.::|:                 |....||||||..||..||..:.
Mouse    68 NSSGGPSAQDGPEATDDSRTQASAAGPCAGGVGGGEGARSKPYTRRPKPPYSYIALIAMAIRDSA 132

  Fly   471 DKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEP-GKGSFWRIDPDS 534
            ..:|||:.|..:::..:|::| .:..||:||:|||||||..|:||.|....| ||.::|.::|:|
Mouse   133 GGRLTLAEINEYLMGKFPFFR-GSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNS 196

  Fly   535 GAKLIDHSYKKRRQR-------SSQGFRP------PYGMP------RSAPVSPSHMDNSRESSP 579
            .....|..:::||:|       |:.|.||      |.|.|      ||:|::.|.......|||
Mouse   197 EYTFADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPAARSSPIARSPARQEERSSP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 37/87 (43%)
Foxq1NP_032265.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 27/108 (25%)
FH 115..193 CDD:238016 35/78 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..264 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.