DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxb2

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_032049.1 Gene:Foxb2 / 14240 MGIID:1347468 Length:428 Species:Mus musculus


Alignment Length:325 Identity:95/325 - (29%)
Similarity:130/325 - (40%) Gaps:91/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 PSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507
            |..:||: ::||||||..|...||..:.:|.|.||.||.||::.:||||:.|.: ||||:|||||
Mouse     4 PGKSSYS-DQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQR-WQNSLRHNLS 66

  Fly   508 LNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR--------------SSQGFRPPY 558
            .|..|||:.|..|:|||||||.:.||.|....:.|:.:||:|              ||:| .|..
Mouse    67 FNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHAHLHSGSSKG-APGT 130

  Fly   559 G-------------------------------MPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSP 592
            |                               .|:..|..|.||.......|      ..||..|
Mouse   131 GPGGHLHPHHPHHAHHHHHHHHHAAHHHHHHHPPQPPPPPPPHMVPYFHQQP------APAPQPP 189

  Fly   593 GMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQYSSGSPYYVTNQSSGVATPQTHV 657
            .:.             ||.|   ||.|.|.|..||......|           :::.||      
Mouse   190 HLP-------------SQPA---QQPQPQSQPPQTSHPGKMQ-----------EAAAVA------ 221

  Fly   658 EGSAASGGGGGGGVGALLALKRNHVMG-GGASQHTLHQQQAVAQQQHSEIIYEELPTDYSGHIEA 721
               ||:.......||::..|.:....| |.|:........:....:|...|...:..||.|.::|
Mouse   222 ---AAAAAAAAAAVGSVGRLSQFPPYGLGSAAAAAAAAAASTTGFKHPFAIENIIGRDYKGVLQA 283

  Fly   722  721
            Mouse   284  283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
Foxb2NP_032049.1 FH 13..101 CDD:214627 47/88 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..217 25/132 (19%)
E_Pc_C <342..>406 CDD:284226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.