DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxj1

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_446284.2 Gene:Foxj1 / 116557 RGDID:621764 Length:421 Species:Rattus norvegicus


Alignment Length:305 Identity:87/305 - (28%)
Similarity:126/305 - (41%) Gaps:88/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PPAGAAAH-------LIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQN 423
            ||.|...|       |:|...|....|..:..|....|     ||.:.::.::.|.      :|.
  Rat    53 PPGGTDPHGYHQVPGLVAPGSPLAADPACLGQPHTPGK-----PTSSCTSRSAPPG------LQA 106

  Fly   424 QPNNYNNYGNNNTQDLFQTPSTASY--NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKH 486
            .|                 |....|  |.:.|||||||.||..|:.|:...::|||.||.:|..:
  Rat   107 PP-----------------PDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDN 154

  Fly   487 YPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKR----- 546
            :.|:| ..:..||||||||||||:.||||.|.:||||||.||||||....:|:..::|||     
  Rat   155 FCYFR-HADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPV 218

  Fly   547 -------RQRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPE 604
                   ||.:.:....|:|.|.:.        |......||:  .:.|.|..|....:      
  Rat   219 HIHPAFARQAAQEPSTAPWGGPLTV--------NREAQQLLQE--FEEATGEGGWGTGE------ 267

  Fly   605 IIYNSQNAHQQQQ------------------QQQQQQQQQTLSNN 631
                .:..|:::|                  .|::|.:.:.|..|
  Rat   268 ----GRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQGELEPLKGN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/86 (57%)
Foxj1NP_446284.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 8/58 (14%)
FH_FOXJ1 121..199 CDD:410797 46/78 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..277 4/30 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.