DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and LOC101730723

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_031760018.1 Gene:LOC101730723 / 101730723 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:235 Identity:71/235 - (30%)
Similarity:108/235 - (45%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 PKKEQKSPYLSPTGTISAAN--SCPASPR---QGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNH 450
            |..|:||   :|    :|||  :.|.||:   :|  ..:|        :::.|..:.....||..
 Frog    18 PSMEKKS---AP----AAANRATLPPSPKGDSEG--PREP--------DSSADWKKKKKKKSYQR 65

  Fly   451 NEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKV 515
            ..||||||..:|...|...|:|:|.||.|...|...:|:: |...:||::|||||||.|..|.||
 Frog    66 YAKPPYSYLAMIALVIQNCPEKRLKLSQILQDISSLFPFF-KGNYQGWKDSIRHNLSSNDCFRKV 129

  Fly   516 ARSQDEP-GKGSFWRID----PDSGAKLIDHSYKKRRQRSSQGFRP----PY---GMPRSAPVSP 568
            .:...:| .||::|.:|    |....||.:.:..:      |...|    ||   |.|.....|.
 Frog   130 LKDPLKPQAKGNYWTVDVTRIPPDALKLQNTAVTR------QDLFPLDLAPYILHGQPYRERHSA 188

  Fly   569 SHMDNSRE-SSPLQDIVLQSAPGSPGMSLEQRAADPEIIY 607
            :|   :|| ::|..:  |:.||..|       .:||.:.:
 Frog   189 NH---TREHTTPRME--LKVAPQIP-------VSDPAVSF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 38/91 (42%)
LOC101730723XP_031760018.1 COG5025 66..>322 CDD:227358 55/170 (32%)
FH_FOXH 68..146 CDD:410796 34/78 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.