Sequence 1: | NP_001261701.1 | Gene: | FoxK / 39252 | FlyBaseID: | FBgn0036134 | Length: | 760 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001230273.1 | Gene: | foxq1a / 100537750 | ZFINID: | ZDB-GENE-070424-74 | Length: | 312 | Species: | Danio rerio |
Alignment Length: | 256 | Identity: | 71/256 - (27%) |
---|---|---|---|
Similarity: | 103/256 - (40%) | Gaps: | 77/256 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 389 SIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNHNEK 453
Fly 454 PPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARS 518
Fly 519 QDEP-GKGSFWRIDPDSGAKLIDHSYKKRRQR-SSQGFRPPYGMPRSAPVSPSHMDNS------- 574
Fly 575 --------------------RESSP--------------LQDIVLQS--APGSPGMSLEQR 599 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FoxK | NP_001261701.1 | FHA | <170..253 | CDD:238017 | |
Forkhead | 453..540 | CDD:278670 | 38/87 (44%) | ||
foxq1a | NP_001230273.1 | FH | 88..177 | CDD:214627 | 39/89 (44%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |