DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and foxe3

DIOPT Version :9

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_002931457.1 Gene:foxe3 / 100495102 XenbaseID:XB-GENE-480592 Length:398 Species:Xenopus tropicalis


Alignment Length:333 Identity:97/333 - (29%)
Similarity:146/333 - (43%) Gaps:71/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 YSPLKISIPKKEQKSPYLSPTGTI----SAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTP 443
            :||.:.:.|  ...||.:...|::    ....:|  ||.:| :...|:.:|.......:   :.|
 Frog    21 HSPTEAASP--IPSSPSMDSPGSVRVKCEPKGTC--SPEEG-VNGLPDEHNQASGGRRR---KRP 77

  Fly   444 STASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSL 508
            .     ...||||||..||..||:.:|:::|||.|||.||::.:|:|| |.:|.|||||||||:|
 Frog    78 I-----QRGKPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYR-ENSKKWQNSIRHNLTL 136

  Fly   509 NRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMDN 573
            |..|:|:.|....||||::|.:||.:.....:.|:.:||:|..:.....|         |.:|.|
 Frog   137 NDCFVKIPREPGHPGKGNYWTLDPAAEDMFDNGSFLRRRKRFKRTDLTTY---------PGYMQN 192

  Fly   574 SRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNA----------------HQQQQQQQQQ 622
            |...:|        .|..       ||:.|..||:|..:                |.|......|
 Frog   193 SSAFTP--------TPAG-------RASYPTSIYSSVGSGYNPQIHQTHHPAMVHHYQPPGGAGQ 242

  Fly   623 QQQQTLSNNS--NQYSSGSP---YYVTNQSSGVATPQTHVEGSAASG--------GGGGGGVGAL 674
            .|.:..|.:|  ||.|...|   ..:|:.|.|:.....::..|.:.|        .....|||:|
 Frog   243 GQHRMFSIDSLINQQSVMQPSPGAELTHHSLGLNGDLGNMTSSCSVGDLSCFQTQSISPTGVGSL 307

  Fly   675 LALKRNHV 682
            |....|.|
 Frog   308 LNRPSNAV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 45/86 (52%)
foxe3XP_002931457.1 FH 82..170 CDD:214627 45/88 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.